ARO-A13520
Tamanho : 100µg
| Product name | ARO-P12825-100 |
|---|---|
| Uniprot ID | Q13950 |
| Origin species | Human |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | VTVDGPREPRRHRQKLDDSKPSLFSDRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPV |
| Molecular weight | 22.80 kDa |
| Buffer | Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol. |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Val219-Val404 |
| Aliases /Synonyms | AML3, OSF2, RUNX2, Core-binding factor subunit alpha-1, PEA2-alpha A, CBF-alpha-1, Osteoblast-specific transcription factor 2, Oncogene AML-3, CBFA1, Runt-related transcription factor 2, PEBP2A, OSF-2, SL3-3 enhancer factor 1 alpha A subunit, PEBP2-alpha A, Acute myeloid leukemia 3 protein, Polyomavirus enhancer-binding protein 2 alpha A subunit, SL3/AKV core-binding factor alpha A subunit |
| Reference | ARO-P12825 |
| Note | For research use only. |
| Molecular Constructor | Val219–Val404 |
| Product name | ARO-P12825-1MG |
|---|---|
| Uniprot ID | Q13950 |
| Origin species | Human |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | VTVDGPREPRRHRQKLDDSKPSLFSDRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPV |
| Molecular weight | 22.80 kDa |
| Buffer | Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol. |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Val219-Val404 |
| Aliases /Synonyms | AML3, OSF2, RUNX2, Core-binding factor subunit alpha-1, PEA2-alpha A, CBF-alpha-1, Osteoblast-specific transcription factor 2, Oncogene AML-3, CBFA1, Runt-related transcription factor 2, PEBP2A, OSF-2, SL3-3 enhancer factor 1 alpha A subunit, PEBP2-alpha A, Acute myeloid leukemia 3 protein, Polyomavirus enhancer-binding protein 2 alpha A subunit, SL3/AKV core-binding factor alpha A subunit |
| Reference | ARO-P12825 |
| Note | For research use only. |
| Molecular Constructor | Val219–Val404 |
| Product name | ARO-P12825-50 |
|---|---|
| Uniprot ID | Q13950 |
| Origin species | Human |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | VTVDGPREPRRHRQKLDDSKPSLFSDRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPV |
| Molecular weight | 22.80 kDa |
| Buffer | Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol. |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Val219-Val404 |
| Aliases /Synonyms | AML3, OSF2, RUNX2, Core-binding factor subunit alpha-1, PEA2-alpha A, CBF-alpha-1, Osteoblast-specific transcription factor 2, Oncogene AML-3, CBFA1, Runt-related transcription factor 2, PEBP2A, OSF-2, SL3-3 enhancer factor 1 alpha A subunit, PEBP2-alpha A, Acute myeloid leukemia 3 protein, Polyomavirus enhancer-binding protein 2 alpha A subunit, SL3/AKV core-binding factor alpha A subunit |
| Reference | ARO-P12825 |
| Note | For research use only. |
| Molecular Constructor | Val219–Val404 |
There are no reviews yet.