RBPJ Peptide - middle region

Cat# orb1997927-100ug

Size : 100ug

Marca : Biorbyt


RBPJ Peptide - middle region

SKU: orb1997927

Description

RBPJ Peptide - middle region, also known as CBF1, RBP-J, RBPjk, Igkjrb, Rbpsuh, Igkrsbp, AI843960, RBP-Jkappa, RBP-J kappa, corresponds to the sequence CVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKN and is supplied as a lyophilized powder. This peptide is for research use only.

Images & Validation

Key Properties

Protein SequenceSynthetic peptide located within the following region: CVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKN

Storage & Handling

StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

CBF1, RBP-J, RBPjk, Igkjrb, Rbpsuh, Igkrsbp, AI843960, RBP-Jkappa, RBP-J kappa

UniProt Details

Loading UniProt data...

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide