LTA recombinant protein

Cat# NB-21-25519

Size : 100ug

Brand : Neo Biotech


LTA recombinant protein

Product name PX-P5015-100
Uniprot ID P01374
Uniprot link https://www.uniprot.org/uniprot/P01374
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
Molecular weight 20.57 kDa
Protein delivered with Tag? His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Host species Escherichia coli (E.coli)
Fragment Type Leu35-Leu205
Protein Accession P01374
Aliases /Synonyms Lymphotoxin-alpha,LT-alpha,TNF-beta,Tumor necrosis factor ligand superfamily member 1, TNFb
Reference PX-P5015
Note For research use only
Molecular Constructor
Leu35–Leu205 His