Host species: Escherichia coli (E.coli) Origin species: Homo sapiens (Human) Uniprot ID: P01374 Molecular weight: 20.57 kDa Leu35–Leu205 His Datasheet MSDS Specifications LTA recombinant protein Product name PX-P5015-100 Uniprot ID P01374 Uniprot link https://www.uniprot.org/uniprot/P01374 Origin species Homo sapiens (Human) Expression system Prokaryotic expression Raw Antigen Sequence LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL Molecular weight 20.57 kDa Protein delivered with Tag? His Tag Purity estimated >90% as determined by SDS-PAGE Buffer PBS, pH7.5 Delivery condition Dry Ice Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) Brand ProteoGenix Host species Escherichia coli (E.coli) Fragment Type Leu35-Leu205 Protein Accession P01374 Aliases /Synonyms Lymphotoxin-alpha,LT-alpha,TNF-beta,Tumor necrosis factor ligand superfamily member 1, TNFb Reference PX-P5015 Note For research use only Molecular Constructor Leu35–Leu205 His Product name PX-P5015-1MG Uniprot ID P01374 Uniprot link https://www.uniprot.org/uniprot/P01374 Origin species Homo sapiens (Human) Expression system Prokaryotic expression Raw Antigen Sequence LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL Molecular weight 20.57 kDa Protein delivered with Tag? His Tag Purity estimated >90% as determined by SDS-PAGE Buffer PBS, pH7.5 Delivery condition Dry Ice Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) Brand ProteoGenix Host species Escherichia coli (E.coli) Fragment Type Leu35-Leu205 Protein Accession P01374 Aliases /Synonyms Lymphotoxin-alpha,LT-alpha,TNF-beta,Tumor necrosis factor ligand superfamily member 1, TNFb Reference PX-P5015 Note For research use only Molecular Constructor Leu35–Leu205 His Product name PX-P5015-50 Uniprot ID P01374 Uniprot link https://www.uniprot.org/uniprot/P01374 Origin species Homo sapiens (Human) Expression system Prokaryotic expression Raw Antigen Sequence LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL Molecular weight 20.57 kDa Protein delivered with Tag? His Tag Purity estimated >90% as determined by SDS-PAGE Buffer PBS, pH7.5 Delivery condition Dry Ice Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) Brand ProteoGenix Host species Escherichia coli (E.coli) Fragment Type Leu35-Leu205 Protein Accession P01374 Aliases /Synonyms Lymphotoxin-alpha,LT-alpha,TNF-beta,Tumor necrosis factor ligand superfamily member 1, TNFb Reference PX-P5015 Note For research use only Molecular Constructor Leu35–Leu205 His Documents Datasheet MSDS 3D Representation Reviews There are no reviews yet. Be the first to review “LTA recombinant protein” Cancel reply
There are no reviews yet.