Cpne6 Antibody - C-terminal region - Biotin
Cat# ARP59454_P050-Biotin
Size : 100ul
Brand : Aviva Systems Biology
Cpne6 Antibody - C-terminal region : Biotin (ARP59454_P050-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-Cpne6 (ARP59454_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Zebrafish: 93% |
| Peptide Sequence | Synthetic peptide located within the following region: YLQALRTVGGICQDYDSDKRFPAFGFGARIPPNFEVSHDFAINFDPENPE |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-Cpne6 (ARP59454_P050-Biotin) antibody is Catalog # AAP59454 (Previous Catalog # AAPP45553) |
| Gene Symbol | Cpne6 |
|---|---|
| Gene Full Name | Copine VI |
| Alias Symbols | AU067659, BB076446 |
| NCBI Gene Id | 12891 |
| Protein Name | Copine-6 |
| Description of Target | Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene is one of several genes that encodes a calcium-dependent protein containing two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. Three transcript variants encoding two different isoforms have been found for this gene. |
| Uniprot ID | Q9Z140 |
| Protein Accession # | NP_034077 |
| Nucleotide Accession # | NM_009947 |
| Protein Size (# AA) | 557 |
| Molecular Weight | 62kDa |
| Protein Interactions | Eed; Os9; |




