Size : 100µg
| Product name | ARO-P16864-100 |
|---|---|
| Uniprot ID | P0DOK8 |
| Origin species | Japanese encephalitis virus (strain M28) (JEV) |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | MKLSNFQGKLLMTINNTDIADVIVIPTSKGENRCWVRAIDVGYMCEDTITYECPKLAVGNDPEDVDCWCDNQEVYVQYGRCTRTRHSKRSRR |
| Molecular weight | 38.84 kDa |
| Protein delivered with Tag? | N-Terminal GST & C-Terminal His Tag |
| Buffer | Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol. |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Met128-Arg219 |
| Aliases /Synonyms | Structural polyprotein, Peptide pr |
| Reference | ARO-P16864 |
| Note | For research use only. |
| Molecular Constructor | GST Met128–Arg219 His |