Clinisciences > ACVR2B Antibody - middle region
ACVR2B Antibody - middle region
Referencia ARP45042_P050-25UL
embalaje : 25ul
Marca : Aviva Systems Biology
ACVR2B Antibody - middle region (ARP45042_P050)
| Datasheets/Manuals | Printable datasheet for anti-ACVR2B (ARP45042_P050) antibody |
|---|
| Tested Species Reactivity | Human, Mouse |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ACVR2B |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 85%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 77%; Rat: 100%; Sheep: 100%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: KSKNVLLKSDLTAVLADFGLAVRFEPGKPPGDTHGQVGTRRYMAPEVLEG |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-ACVR2B (ARP45042_P050) antibody is Catalog # AAP45042 (Previous Catalog # AAPP12330) |
| Gene Symbol | ACVR2B |
|---|---|
| Gene Full Name | Activin A receptor, type IIB |
| Alias Symbols | HTX4, ACTRIIB, ActR-IIB |
| NCBI Gene Id | 93 |
| Protein Name | Activin receptor type-2B |
| Description of Target | Activin receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. Type II receptors are considered to be constitutively active kinases. ACVR2B is activin A type IIB receptor, which displays a 3- to 4-fold higher affinity for the ligand than activin A type II receptor. |
| Uniprot ID | Q13705 |
| Protein Accession # | NP_001097 |
| Nucleotide Accession # | NM_001106 |
| Protein Size (# AA) | 512 |
| Molecular Weight | 58kDa |
| Protein Interactions | GDF2; BMP10; INHBA; PEG10; ERBB2IP; HSP90AA1; SMAD7; SMAD6; SMAD2; IGSF1; SYNJ2BP; SNX6; SNX2; TGFBRAP1; GDF11; MSTN; ACVR1B; SNX1; INHBC; GDF5; INHBB; BMP7; BMP2; ENG; BMP6; |
Protein interactions
| Name | # of Products |
|---|---|
| ACVR1B | 26 |
| BMP2 | 50 |
| BMP6 | 8 |
| BMP7 | 31 |
| ENG | 59 |
| GDF11 | 3 |
| GDF5 | 8 |
| IGSF1 | 16 |
| INHBA | 40 |
| INHBB | 22 |
| INHBC | 6 |
| MSTN | 10 |
| SNX1 | 29 |
| SNX2 | 42 |
| SNX6 | 48 |
| SYNJ2BP | 21 |
| TGFBRAP1 | 24 |
Biological pathways
| Name | # of Products |
|---|---|
| Activin receptor signaling pathway | 8 |
| Anterior/posterior pattern specification | 69 |
| BMP signaling pathway | 101 |
| Positive regulation of activin receptor signaling pathway | 3 |
| Positive regulation of bone mineralization | 99 |
| Positive regulation of osteoblast differentiation | 109 |
| Regulation of transcription, DNA-dependent | 1489 |
Biological process
| Name | # of Products |
|---|---|
| Activation of protein kinase activity | 27 |
| Anterior/posterior pattern specification | 119 |
| BMP signaling pathway | 66 |
| Determination of left/right symmetry | 39 |
| Embryonic foregut morphogenesis | 12 |
| Gastrulation with mouth forming second | 16 |
| Heart development | 186 |
| Insulin secretion | 30 |
| Kidney development | 92 |
| Lung development | 105 |
| Mesoderm development | 34 |
| Odontogenesis of dentin-containing tooth | 59 |
| Organ growth | 10 |
| Palate development | 67 |
| Pancreas development | 34 |
| Pattern specification process | 111 |
| Positive regulation of activin receptor signaling pathway | 1 |
| Positive regulation of bone mineralization | 35 |
| Positive regulation of osteoblast differentiation | 59 |
| Post-embryonic development | 74 |
| Regulation of transcription, DNA-dependent | 1734 |
| Response to glucose stimulus | 72 |
| Signal transduction | 1058 |
| Skeletal system morphogenesis | 30 |
| Transmembrane receptor protein serine/threonine kinase signaling pathway | 6 |
Cellular components
| Name | # of Products |
|---|---|
| Cell surface | 369 |
| Cytoplasm | 4549 |
| Integral to plasma membrane | 817 |
| Plasma membrane | 2678 |
Protein function
| Name | # of Products |
|---|---|
| Activin binding | 39 |
| Activin receptor activity, type II | 14 |
| ATP binding | 2814 |
| Growth factor binding | 81 |
| Inhibin beta-A binding | 15 |
| Inhibin beta-B binding | 8 |
| Metal ion binding | 5514 |
| Nucleotide binding | 3928 |
| Protein binding | 12191 |
| Protein serine/threonine kinase activity | 738 |
| Protein serine/threonine/tyrosine kinase activity | 63 |
| Receptor activity | 3624 |
| Receptor signaling protein serine/threonine kinase activity | 20 |
| Transforming growth factor beta-activated receptor activity | 33 |
| Transmembrane receptor protein serine/threonine kinase activity | 27 |
Diseases
| Name | # of Products |
|---|---|
| Disease mutation | 5332 |
| Heterotaxy | 11 |
-
ACVR2B Antibody - C-terminal region (ARP45043_P050)Catalog #: ARP45043_P050Species Tested: HumanApplication: WBFormat: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. -
ACVR2B Antibody - middle region (ARP45041_P050)Catalog #: ARP45041_P050Species Tested: Human, MouseApplication: WBFormat: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. -
ACVR2B Recombinant Protein (Human) (OPCA03113)Catalog #: OPCA03113Format: Liquid or Lyophilized powder


