embalaje : 50ug
| Product name | Interleukin-4 |
|---|---|
| Uniprot ID | P05112 |
| Uniprot link | https://www.uniprot.org/uniprot/P05112 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | GHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKC |
| Molecular weight | 16.20kDa |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >38% by SDS-PAGE |
| Buffer | PBS pH 7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Gly24-Ser154 |
| Protein Accession | P05112 |
| Spec:Entrez GeneID | 3565 |
| Spec:NCBI Gene Aliases | BSF1; IL-4; BCGF1; BSF-1; BCGF-1 |
| Spec:SwissProtID | Q14630 |
| NCBI Reference | P05112 |
| Aliases /Synonyms | B-cell stimulatory factor 1、BSF-1、Binetrakin、Lymphocyte stimulatory factor 1、Pitrakinra, IL4, IL-4 |
| Reference | PX-P4558 |
| Note | For research use only |
| Molecular Constructor | Gly24–Ser154 His |