ARO-A14918
embalaje : 100µg
| Product name | ARO-P13110-100 |
|---|---|
| Uniprot ID | Q9H3D4 |
| Origin species | Human |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | SQSTQTNEFLSPEVFQHIWDFLEQPICSVQPIDLNFVDEPSEDGATNKIEISMDCIRMQDSDLSDPMWPQYTNLGLLNSMDQQIQNGSSSTSPYNTDHAQNSVTAPSPYAQPSSTFDALSPSPAIPSNTDYPGPHSFDVSFQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKVMTPPPQGAVIRAMPVYKKAEHVTEVVKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRC |
| Molecular weight | 35.56 kDa |
| Buffer | Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol. |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Ser41-Cys339 |
| Aliases /Synonyms | Keratinocyte transcription factor KET, P63, KET, Tumor protein p73-like, p63, P73L, CUSP, P73H, p40, Tumor protein 63, TP73L, Transformation-related protein 63, TP63, Chronic ulcerative stomatitis protein, p73L, p51 |
| Reference | ARO-P13110 |
| Note | For research use only. |
| Molecular Constructor | Ser41–Cys339 |
| Product name | ARO-P13110-1MG |
|---|---|
| Uniprot ID | Q9H3D4 |
| Origin species | Human |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | SQSTQTNEFLSPEVFQHIWDFLEQPICSVQPIDLNFVDEPSEDGATNKIEISMDCIRMQDSDLSDPMWPQYTNLGLLNSMDQQIQNGSSSTSPYNTDHAQNSVTAPSPYAQPSSTFDALSPSPAIPSNTDYPGPHSFDVSFQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKVMTPPPQGAVIRAMPVYKKAEHVTEVVKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRC |
| Molecular weight | 35.56 kDa |
| Buffer | Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol. |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Ser41-Cys339 |
| Aliases /Synonyms | Keratinocyte transcription factor KET, P63, KET, Tumor protein p73-like, p63, P73L, CUSP, P73H, p40, Tumor protein 63, TP73L, Transformation-related protein 63, TP63, Chronic ulcerative stomatitis protein, p73L, p51 |
| Reference | ARO-P13110 |
| Note | For research use only. |
| Molecular Constructor | Ser41–Cys339 |
| Product name | ARO-P13110-50 |
|---|---|
| Uniprot ID | Q9H3D4 |
| Origin species | Human |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | SQSTQTNEFLSPEVFQHIWDFLEQPICSVQPIDLNFVDEPSEDGATNKIEISMDCIRMQDSDLSDPMWPQYTNLGLLNSMDQQIQNGSSSTSPYNTDHAQNSVTAPSPYAQPSSTFDALSPSPAIPSNTDYPGPHSFDVSFQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKVMTPPPQGAVIRAMPVYKKAEHVTEVVKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRC |
| Molecular weight | 35.56 kDa |
| Buffer | Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol. |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Ser41-Cys339 |
| Aliases /Synonyms | Keratinocyte transcription factor KET, P63, KET, Tumor protein p73-like, p63, P73L, CUSP, P73H, p40, Tumor protein 63, TP73L, Transformation-related protein 63, TP63, Chronic ulcerative stomatitis protein, p73L, p51 |
| Reference | ARO-P13110 |
| Note | For research use only. |
| Molecular Constructor | Ser41–Cys339 |
There are no reviews yet.