Recombinant Human DDX4, N-His

Referencia NB-21-30340

embalaje : 100µg

Marca : Neo Biotech


Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US (" height="17" viewBox="0 0 17 17" fill="none" xmlns="http://www.w3.org/2000/svg"> Close

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Close
Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NQI0
Molecular weight:
12.96 kDa
Asn35–Gly131

Specifications Recombinant Human DDX4, N-His

Product name ARO-P13069-100
Uniprot ID Q9NQI0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NRTPASSSEMDDGPSRRDHFMKSGFASGRNFGNRDAGECNKRDNTSTMGGFGVGKSFGNRGFSNSRFEDGDSSGFWRESSNDCEDNPTRNRGFSKRG
Molecular weight 12.96 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn35-Gly131
Aliases /Synonyms DDX4, VASA, Vasa homolog, DEAD box protein 4, Probable ATP-dependent RNA helicase DDX4
Reference ARO-P13069
Note For research use only.
Molecular Constructor
Asn35–Gly131
Product name ARO-P13069-1MG
Uniprot ID Q9NQI0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NRTPASSSEMDDGPSRRDHFMKSGFASGRNFGNRDAGECNKRDNTSTMGGFGVGKSFGNRGFSNSRFEDGDSSGFWRESSNDCEDNPTRNRGFSKRG
Molecular weight 12.96 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn35-Gly131
Aliases /Synonyms DDX4, VASA, Vasa homolog, DEAD box protein 4, Probable ATP-dependent RNA helicase DDX4
Reference ARO-P13069
Note For research use only.
Molecular Constructor
Asn35–Gly131
Product name ARO-P13069-50
Uniprot ID Q9NQI0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NRTPASSSEMDDGPSRRDHFMKSGFASGRNFGNRDAGECNKRDNTSTMGGFGVGKSFGNRGFSNSRFEDGDSSGFWRESSNDCEDNPTRNRGFSKRG
Molecular weight 12.96 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn35-Gly131
Aliases /Synonyms DDX4, VASA, Vasa homolog, DEAD box protein 4, Probable ATP-dependent RNA helicase DDX4
Reference ARO-P13069
Note For research use only.
Molecular Constructor
Asn35–Gly131

Documents

3D Representation

Recombinant Human DDX4, N-His

Reviews

There are no reviews yet.

Be the first to review “Recombinant Human DDX4, N-His” Cancel reply

Related products

  • SDS-PAGE for Anti-Human DDX4/Vasa Antibody (ABS0427)

    ARO-A17741

    Anti-Human DDX4/Vasa Antibody (ABS0427)