NB-21-24438 | CD91 Recombinant Protein Clinisciences

Host species:: Escherichia coli (E.coli)
Origin species:: Homo sapiens (Human)
Uniprot ID:: Q07954
Molecular weight:: 37kDa

His Ala20~Gly292

Datasheet

Specifications CD91 Recombinant Protein

Product name	PX-P4094-100
Uniprot ID	Q07954
Uniprot link	http://www.uniprot.org/uniprot/Q07954
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Raw Antigen Sequence	AIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEAPEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELQGNCSRLGCQHHCVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGSFICGCVEGYLLQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCARMPGLKGFVDEHTINISLSLHLCVFSKSQQEMG
Molecular weight	37kDa
Protein delivered with Tag?	N-terminal His Tag
Purity estimated	>90% by SDS-PAGE
Buffer	PBS pH7.5
Delivery condition	Dry Ice
Storage condition	Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Ala20~Gly292
Aliases /Synonyms	A2MR,APR
Reference	PX-P4094
Note	For research use only
Molecular Constructor	His Ala20~Gly292

Product name	PX-P4094-1MG
Uniprot ID	Q07954
Uniprot link	http://www.uniprot.org/uniprot/Q07954
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Raw Antigen Sequence	AIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEAPEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELQGNCSRLGCQHHCVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGSFICGCVEGYLLQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCARMPGLKGFVDEHTINISLSLHLCVFSKSQQEMG
Molecular weight	37kDa
Protein delivered with Tag?	N-terminal His Tag
Purity estimated	>90% by SDS-PAGE
Buffer	PBS pH7.5
Delivery condition	Dry Ice
Storage condition	Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Ala20~Gly292
Aliases /Synonyms	A2MR,APR
Reference	PX-P4094
Note	For research use only
Molecular Constructor	His Ala20~Gly292

Product name	PX-P4094-50
Uniprot ID	Q07954
Uniprot link	http://www.uniprot.org/uniprot/Q07954
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Raw Antigen Sequence	AIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEAPEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELQGNCSRLGCQHHCVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGSFICGCVEGYLLQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCARMPGLKGFVDEHTINISLSLHLCVFSKSQQEMG
Molecular weight	37kDa
Protein delivered with Tag?	N-terminal His Tag
Purity estimated	>90% by SDS-PAGE
Buffer	PBS pH7.5
Delivery condition	Dry Ice
Storage condition	Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Ala20~Gly292
Aliases /Synonyms	A2MR,APR
Reference	PX-P4094
Note	For research use only
Molecular Constructor	His Ala20~Gly292

Description

General Information about CD91 Recombinant Protein

The 1 receptor of the related 1-lipoprotein protein (LRP1), also known as alpha-2-macroglobulin receptor (A2MR), apolipoprotein E receptor (APOER) or differentiation cluster 91 (CD91), is a Protein forming a receptor, which is present in cells and participate in receptor-mediated endocytosis. In humans, the LRP1 protein is encoded by the LRP1 gene. LRP1 is also a key signaling protein and is therefore involved in several biological processes, such as lipoprotein metabolism and cell movement, as well as neurodegenerative diseases, atherosclerosis and cancer.

Documents

Datasheet

QC & Validation

SDS-PAGE for CD91 Recombinant Protein

CD91 Recombinant Protein on SDS-PAGE under reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is superior than 90 %

3D Representation

Reviews

There are no reviews yet.

Be the first to review “CD91 Recombinant Protein” Cancel reply

CD91 Recombinant Protein

Referencia NB-21-24438

Marca : Neo Biotech