Estrogen receptor (in E.coli)

Referencia NB-21-24567

embalaje : 50ug

Marca : Neo Biotech


Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P03372
Molecular weight:
29.47 kDa
Met297–Ser554 N terminus His

Specifications Estrogen receptor (in E.coli)

Product name Estrogen receptor (in E.coli)
Uniprot ID P03372
Uniprot link https://www.uniprot.org/uniprot/P03372
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTS
Molecular weight 29.47 kDa
Protein delivered with Tag? N terminus His tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met297-Ser554
Protein Accession P03372
Spec:Entrez GeneID 2099
Spec:NCBI Gene Aliases ER; ESR; Era; ESRA; ESTRR; NR3A1
Spec:SwissProtID Q9UIS7
NCBI Reference P03372
Aliases /Synonyms ER, ER-alpha,Estradiol receptor,Nuclear receptor subfamily 3 group A member 1,ESR, NR3A1
Reference PX-P4797
Note For research use only
Molecular Constructor
Met297–Ser554 N terminus His
Product name Estrogen receptor (in E.coli)
Uniprot ID P03372
Uniprot link https://www.uniprot.org/uniprot/P03372
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTS
Molecular weight 29.47 kDa
Protein delivered with Tag? N terminus His tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met297-Ser554
Protein Accession P03372
Spec:Entrez GeneID 2099
Spec:NCBI Gene Aliases ER; ESR; Era; ESRA; ESTRR; NR3A1
Spec:SwissProtID Q9UIS7
NCBI Reference P03372
Aliases /Synonyms ER, ER-alpha,Estradiol receptor,Nuclear receptor subfamily 3 group A member 1,ESR, NR3A1
Reference PX-P4797
Note For research use only
Molecular Constructor
Met297–Ser554 N terminus His
Product name PX-P4797-1MG
Uniprot ID P03372
Uniprot link https://www.uniprot.org/uniprot/P03372
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTS
Molecular weight 29.47 kDa
Protein delivered with Tag? N terminus His tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met297-Ser554
Protein Accession P03372
Spec:Entrez GeneID 2099
Spec:NCBI Gene Aliases ER; ESR; Era; ESRA; ESTRR; NR3A1
Spec:SwissProtID Q9UIS7
NCBI Reference P03372
Aliases /Synonyms ER, ER-alpha,Estradiol receptor,Nuclear receptor subfamily 3 group A member 1,ESR, NR3A1
Reference PX-P4797
Note For research use only
Molecular Constructor
Met297–Ser554 N terminus His

Documents

QC & Validation

SDS-PAGE for Estrogen receptor (in E.coli)

SDS-PAGE for Estrogen receptor (in E.coli)

Estrogen receptor (in E.coli), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

3D Representation

Estrogen receptor (in E.coli)

Reviews

There are no reviews yet.

Be the first to review “Estrogen receptor (in E.coli)” Cancel reply

Related products

  • CD340 Recombinant Protein binds to Trastuzumab Biosimilar - Anti-HER2 mAb in indirect ELISA assay

    PX-TA1005

    Trastuzumab Biosimilar Antibody (Anti-HER2)