YAP1 (Yes-Associated Protein 1, 65kD, YAP, YAP2, YAP65, YKI)
Referencia 253500-100ug
embalaje : 100ug
Marca : US Biological
253500 YAP1 (Yes-Associated Protein 1, 65kD, YAP, YAP2, YAP65, YKI)
Clone Type
MonoclonalHost
mouseSource
humanIsotype
IgG2a,kGrade
PurifiedApplications
E IF IHC WBAccession #
NP_006097Shipping Temp
Blue IceStorage Temp
-20°CThis gene encodes the human ortholog of chicken YAP protein which binds to the SH3 domain of the Yes proto-oncogene product. This protein contains a WW domain that is found in various structural, regulatory and signaling molecules in yeast, nematode, and mammals, and may be involved in protein-protein interaction. [provided by RefSeq
Applications:
Suitable for use in ELISA, Immunofluorescence, Western Blot and Immunohistochemistry. Other applications not tested.
Recommended Dilution:
Immunohistochemistry: Formalin fixed paraffin embedded.
Optimal dilutions to be determined by the researcher.
AA Sequence:
QIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR
Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

